Loading...
Statistics
Advertisement

:: Shaher United Trading & Cont Co ::
www.shaherunited.com/

Shaherunited.com

Advertisement
Conversion Technology Metas Server
Shaherunited.com is hosted in United States / Culver City . Shaherunited.com uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Swf Object, Number of used javascripts: 1. First javascripts: Mm_menu.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.22.

Technologies in use by Shaherunited.com

Technology

Number of occurences: 3
  • CSS
  • Html
  • Swf Object

Advertisement

Javascripts

Number of occurences: 1
  • mm_menu.js

Server Type

  • Apache/2.2.22

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Shaherunited.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.gridserver.com
    • subject:
      • OU: Domain Control Validated
      • CN: *.gridserver.com
    • hash: d8a988c8
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 11198607473376485
    • validFrom: 140411163449Z
    • validTo: 170411163449Z
    • validFrom_time_t: 1397234089
    • validTo_time_t: 1491928489
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-40.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:*.gridserver.com, DNS:gridserver.com
      • subjectKeyIdentifier: 06:65:8B:66:B6:62:E2:D2:7E:DD:30:B7:5A:00:F3:B2:75:BC:34:95

Meta - Shaherunited.com

Number of occurences: 2
  • Name: keywords
    Content: Shaher oman,Shaher united,oman,electrical engineering,motor,generator,transformer,Shaher United Trading & Cont Co
  • Name:
    Content: text/html; charset=iso-8859-1

Server / Hosting

  • IP: 64.13.232.151
  • Latitude: 34.02
  • Longitude: -118.39
  • Country: United States
  • City: Culver City

Rname

  • infoserviz.mars.orderbox-dns.com
  • infoserviz.mercury.orderbox-dns.com
  • infoserviz.earth.orderbox-dns.com
  • infoserviz.venus.orderbox-dns.com
  • mx2.mailhostbox.com
  • mx3.mailhostbox.com
  • mx1.mailhostbox.com

Target

  • amlpetro.omantel.net.om

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 24 Apr 2016 15:11:28 GMT Server: Apache/2.2.22 Last-Modified: Mon, 08 Dec 2014 09:16:45 GMT ETag: "fb83a0-4567-509b0e2aef450" Accept-Ranges: bytes Content-Length: 17767 Vary: Accept-Encoding,User-Agent Content-Type: text/html

DNS

host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: A
  4. ip: 64.13.232.151
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: infoserviz.mars.orderbox-dns.com
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: infoserviz.mercury.orderbox-dns.com
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: infoserviz.earth.orderbox-dns.com
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: NS
  4. target: infoserviz.venus.orderbox-dns.com
host: shaherunited.com
  1. class: IN
  2. ttl: 14400
  3. type: SOA
  4. mname: infoserviz.mercury.orderbox-dns.com
  5. rname: amlpetro.omantel.net.om
  6. serial: 2015041501
  7. refresh: 7200
  8. retry: 7200
  9. expire: 172800
  10. minimum-ttl: 7200
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: MX
  4. pri: 100
  5. target: mx2.mailhostbox.com
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: MX
  4. pri: 100
  5. target: mx3.mailhostbox.com
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: MX
  4. pri: 100
  5. target: mx1.mailhostbox.com
host: shaherunited.com
  1. class: IN
  2. ttl: 38400
  3. type: TXT
  4. txt: v=spf1 redirect=_spf.mailhostbox.com
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.haherunited.com, www.sehaherunited.com, www.ehaherunited.com, www.swhaherunited.com, www.whaherunited.com, www.sdhaherunited.com, www.dhaherunited.com, www.sxhaherunited.com, www.xhaherunited.com, www.sfhaherunited.com, www.fhaherunited.com, www.sghaherunited.com, www.ghaherunited.com, www.sthaherunited.com, www.thaherunited.com, www.saherunited.com, www.sheaherunited.com, www.seaherunited.com, www.shdaherunited.com, www.sdaherunited.com, www.shcaherunited.com, www.scaherunited.com, www.shuaherunited.com, www.suaherunited.com, www.shjaherunited.com, www.sjaherunited.com, www.shaherunited.com, www.saherunited.com, www.shbaherunited.com, www.sbaherunited.com, www.shgaherunited.com, www.sgaherunited.com, www.shherunited.com, www.shaoherunited.com, www.shoherunited.com, www.shapherunited.com, www.shpherunited.com, www.sha9herunited.com, www.sh9herunited.com, www.shaherunited.com, www.shherunited.com, www.shaiherunited.com, www.shiherunited.com, www.shauherunited.com, www.shuherunited.com, www.shaerunited.com, www.shaheerunited.com, www.shaeerunited.com, www.shahderunited.com, www.shaderunited.com, www.shahcerunited.com, www.shacerunited.com, www.shahuerunited.com, www.shauerunited.com, www.shahjerunited.com, www.shajerunited.com, www.shaherunited.com, www.shaerunited.com, www.shahberunited.com, www.shaberunited.com, www.shahgerunited.com, www.shagerunited.com, www.shahrunited.com, www.shahexrunited.com, www.shahxrunited.com, www.shahesrunited.com, www.shahsrunited.com, www.shahewrunited.com, www.shahwrunited.com, www.shaherrunited.com, www.shahrrunited.com, www.shahefrunited.com, www.shahfrunited.com, www.shahevrunited.com, www.shahvrunited.com, www.shahecrunited.com, www.shahcrunited.com, www.shaheqrunited.com, www.shahqrunited.com, www.shahearunited.com, www.shaharunited.com, www.shaheyrunited.com, www.shahyrunited.com, www.shaheunited.com, www.shaheriunited.com, www.shaheiunited.com, www.shaherounited.com, www.shaheounited.com, www.shaherlunited.com, www.shahelunited.com, www.shaherlunited.com, www.shahelunited.com, www.shaher.united.com, www.shahe.united.com, www.shahernited.com, www.shaheruwnited.com, www.shaherwnited.com, www.shaheruenited.com, www.shaherenited.com, www.shaherusnited.com, www.shahersnited.com, www.shaheruanited.com, www.shaheranited.com, www.shaheruited.com, www.shaherunnited.com, www.shaherunited.com, www.shaherunhited.com, www.shaheruhited.com, www.shaherunjited.com, www.shaherujited.com, www.shaherunkited.com, www.shaherukited.com, www.shaherunlited.com, www.shaherulited.com, www.shaherun ited.com, www.shaheru ited.com, www.shaherunted.com, www.shaherunirted.com, www.shaherunrted.com, www.shaherunifted.com, www.shaherunfted.com, www.shaherunivted.com, www.shaherunvted.com, www.shaherunikted.com, www.shaherunkted.com, www.shaheruni,ted.com, www.shaherun,ted.com, www.shaherunibted.com, www.shaherunbted.com, www.shaherunigted.com, www.shaherungted.com, www.shaherunitted.com, www.shaheruntted.com, www.shaheruniyted.com, www.shaherunyted.com, www.shaheruniuted.com, www.shaherunuted.com, www.shaherunijted.com, www.shaherunjted.com, www.shaherunimted.com, www.shaherunmted.com, www.shaheruninted.com, www.shaherunnted.com, www.shaherunied.com, www.shaherunitqed.com, www.shaheruniqed.com, www.shaherunitaed.com, www.shaheruniaed.com, www.shaherunit ed.com, www.shaheruni ed.com, www.shaherunitwed.com, www.shaheruniwed.com, www.shaheruniteed.com, www.shaherunieed.com, www.shaherunitzed.com, www.shaherunized.com, www.shaherunitxed.com, www.shaherunixed.com, www.shaherunitced.com, www.shaheruniced.com, www.shaherunitd.com, www.shaherunitexd.com, www.shaherunitxd.com, www.shaherunitesd.com, www.shaherunitsd.com, www.shaherunitewd.com, www.shaherunitwd.com, www.shaheruniterd.com, www.shaherunitrd.com, www.shaherunitefd.com, www.shaherunitfd.com, www.shaherunitevd.com, www.shaherunitvd.com, www.shaherunitecd.com, www.shaherunitcd.com, www.shaheruniteqd.com, www.shaherunitqd.com, www.shaherunitead.com, www.shaherunitad.com, www.shaheruniteyd.com, www.shaherunityd.com,

Other websites we recently analyzed

  1. Mijn Talent
    Netherlands - 109.71.51.117
    Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Google Font API, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  2. smallkitchenappliancesreviews.com
    Scottsdale (United States) - 184.168.221.104
    Server software: Microsoft-IIS/7.5
    Technology: Html
  3. Welcome to www.rolandkessel.nl
    www.rolandkessel.nl
    Netherlands - 83.96.159.15
    Server software: Apache/2
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 5
  4. performancecarsales.co.uk
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  5. Bible Sayings of the Fathers - sayings of moses, sayings of abraham, sayings of Isaach, sayings of Jacob
    Scottsdale (United States) - 23.229.188.67
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  6. © 2016 BAVUKISE
    coming soon template based on HTML5
    South Africa - 41.185.8.62
    Server software: Apache
    Technology: CSS, Google Font API, Html, Php, Google Analytics
    Number of Javascript: 5
    Number of meta tags: 5
  7. weekend365 - Home
    weekend365 ordnance survey map-based gifts
    San Francisco (United States) - 199.34.228.100
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 5
    Number of meta tags: 3
  8. gulfdrug.net
    Road Town (Virgin Islands, British) - 208.91.197.132
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  9. 一般社団法人UIW | ベトナム人介護福祉士の教育・就労支援サービス
    ...
    Osaka (Japan) - 183.90.253.47
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, Carousel, CSS, Flexslider, Font Awesome, Html, Iframe, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3
  10. The White Eagle, Rhoscolyn, Anglesey
    Located by the sandy dunes of Rhosneigr, just a few seconds walk from the award winning Broad Beach (Traeth Llydan), The Oyster Catcher is the ultimate beachside destination.
    Maidenhead (United Kingdom) - 185.24.99.98
    G Analytics ID: UA-74202144-4
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, OSS CDN, AJAX Libraries API, CSS, Font Awesome, Google Font API, Html, Html5, Php, Google Analytics
    Number of Javascript: 5
    Number of meta tags: 4

Check Other Websites